PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021924-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 392aa    MW: 43976.1 Da    PI: 8.4664
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021924-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
    NNU_021924-RA 14 KGLWSPEEDEKLLKYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding48.32.2e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++++++ lG++ W+ Ia  ++ gRt++++k++w++
    NNU_021924-RA  67 RGTFSQQEEKLIIELHAVLGNR-WSQIAGQLP-GRTDNEIKNFWNS 110
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.96965IPR017930Myb domain
SuperFamilySSF466899.36E-3012108IPR009057Homeodomain-like
SMARTSM007179.1E-141363IPR001005SANT/Myb domain
PfamPF002493.9E-161461IPR001005SANT/Myb domain
CDDcd001674.48E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.08166116IPR017930Myb domain
PfamPF002495.1E-1467110IPR001005SANT/Myb domain
CDDcd001677.04E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLKYIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEEKLIIE LHAVLGNRWS QIAGQLPGRT DNEIKNFWNS CIKKKLRQRI  120
PEPKPPLVGG IRYPLEGCLS SKINNNLNDS ITPTQTTKDF FLDRFVTSHE SSSSSRPSDS  180
VTCFPLQQLN YDGSNAGLSA NTNPSLWFNQ NYRPFEMNSE FNSNTISTVL PSASTSVLPT  240
PVGIRPALTG SFSINGVHYW QTGSSSNSSS SSSGSNSSIE LQGNNSFFDN AVFSWGLADC  300
RASDKQTQIH PIEGEPEDLK WSEFLHNPLL MASTLQNQTP QPIYSDIKSE AQFITDGPST  360
SWQQNQQQQQ QLQASDVYAK DFQRLAAVFG QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276091.11e-168PREDICTED: transcription factor MYB86
TrEMBLH9XUF21e-174H9XUF2_9MAGN; R2R3-MYB transcription factor MYB2
STRINGVIT_14s0060g00240.t011e-168(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-92myb domain protein 61